FAM3B Antibody - #DF6227

WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Human,Mouse,Rat

Polyclonal

FAM3B Antibody detects endogenous levels of total FAM3B.

AB_2838193
引用形式: Affinity Biosciences Cat# DF6227, RRID:AB_2838193.

Unconjugated.

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

P58499(FAM3B_HUMAN) >>Visit HPA database.

P58499 FAM3B_HUMAN:

Highly expressed in the pancreas. Also found in the colon, kidney, prostate, small intestine and testis.

FAM3B (family with sequence similarity 3, member B), also known as ORF9, C21orf11 or PANDER, is a 235 amino acid secreted protein that localizes to discrete vesicular and perinuclear structures. Expressed at high levels in pancreas and at lower levels in kidney, colon, testis, prostate and small intestine, FAM3B functions as an islet-specific cytokine that promotes apoptosis and may inhibit Insulin secretion from beta-cells, possibly playing a role in overall pancreatic activity. Human FAM3B shares 78% sequence identity with its mouse counterpart, suggesting a conserved role between species. Three isoforms of FAM3B, designated A, B and C, exist due to alternative splicing events. The gene encoding FAM3B maps to human chromosome 21, which houses approximately 300 genes and comprises nearly 1.5% of the human genome.

•    P58499 FAM3B_HUMAN:
• Protein BLAST With
• NCBI/
• ExPASy/
• Uniprot

MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS