Angiopoietin 2 Antibody - #DF6137

WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Human,Mouse,Rat

Polyclonal

Angiopoietin 2 Antibody detects endogenous levels of total Angiopoietin 2.

AB_2838104
引用形式: Affinity Biosciences Cat# DF6137, RRID:AB_2838104.

Unconjugated.

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

O15123(ANGP2_HUMAN) >>Visit HPA database.

Angiopoietins are a family of Tie receptor ligands. There are four angiopoietins discovered so far: angiopoietins 1, 2, 3 and 4 (Ang1, 2, 3, and 4) (1-3). Ang1 binds to the Tie-2 receptor and leads to its autophosphorylation and subsequent activation of downstream signaling pathways. It plays an important role in blood vessel formation, maturation and subsequent stabilization (1,4,5). Ang2 is an endothelium-specific growth factor that functions as an antagonist to Ang1, promotes vascular associated proinflammatory function, destabilizes quiescent endothelium, leads to vascular leakage and vascular destablization and remodeling (2,6,7). Ang2 is selectively expressed in many tumor tissues where, combined with other growth factors such as VEGF, it can promote vascular remodeling, angiogenesis and inflammation (7-9).

•    O15123 ANGP2_HUMAN:
• Protein BLAST With
• NCBI/
• ExPASy/
• Uniprot

MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF