Control Products
製品説明
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
引用形式: Affinity Biosciences Cat# DF9017, RRID:AB_2842213.
折りたたみ／展開
cancer/testis antigen family 3, member 6; CT3.6; MAGB4_HUMAN; MAGE B4 antigen; MAGE-B4 antigen; MAGEB4; melanoma antigen family B, 4; Melanoma associated antigen B4; Melanoma-associated antigen B4; MGC33144; Cancer/testis antigen 3.1; CT3.1; DAM10; DSS AHC critical interval MAGE superfamily 10; DSS-AHC critical interval MAGE superfamily 10; MAGB1_HUMAN; MAGE B1 antigen; MAGE Xp; MAGE-B1 antigen; MAGE-XP antigen; MAGEB1; MAGEL1; MAGEXP antigen; melanoma antigen family B, 1; Melanoma associated antigen B1; Melanoma-associated antigen B1; MGC9322; Cancer/testis antigen 3.2; Cancer/testis antigen family 3, member 2; CT3.2; DAM6; DSS AHC critical interval MAGE superfamily 6; DSS/AHC critical interval gene, from MAGE superfamily, 6; MAGE B2 antigen; MAGE XP 2; MAGE XP 2 antigen; Mage-b2; Mage-rs2; melanoma antigen family B, 2; Melanoma antigen, family B, 1; Melanoma associated antigen B2; MGC2643; MGC26438; Smage-2 protein; Smage2; FLJ32965; MAGBA_HUMAN; MAGE B10 antigen; MAGE family testis and tumor specific protein; MAGE-B10 antigen; MAGEB10; melanoma antigen family B, 10; Melanoma associated antigen B10; Melanoma-associated antigen B10; MGC120394; OTTHUMP00000043236; B430216B18Rik; MAGBI_HUMAN; MAGE-B18 antigen; MAGEB18; MAGEB18 antigen; Melanoma antigen family B, 18; Melanoma-associated antigen B18; MGC114496; RGD1560369; RP23-289C5.3;
免疫原
A synthesized peptide derived from human MAGB4, corresponding to a region within the internal amino acids.
O15481(MAGB4_HUMAN) >>Visit HPA database.
P43366(MAGB1_HUMAN) >>Visit HPA database.
O15479(MAGB2_HUMAN) >>Visit HPA database.
Expressed in testis.
P43366 MAGB1_HUMAN:Expressed only in testis.
O15479 MAGB2_HUMAN:Expressed in testis and placenta, and in a significant fraction of tumors of various histologic types.
- O15481 MAGB4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPRGQKSKLRAREKRQRTRGQTQDLKVGQPTAAEKEESPSSSSSVLRDTASSSLAFGIPQEPQREPPTTSAAAAMSCTGSDKGDESQDEENASSSQASTSTERSLKDSLTRKTKMLVQFLLYKYKMKEPTTKAEMLKIISKKYKEHFPEIFRKVSQRTELVFGLALKEVNPTTHSYILVSMLGPNDGNQSSAWTLPRNGLLMPLLSVIFLNGNCAREEEIWEFLNMLGIYDGKRHLIFGEPRKLITQDLVQEKYLEYQQVPNSDPPRYQFLWGPRAHAETSKMKVLEFLAKVNDTTPNNFPLLYEEALRDEEERAGARPRVAARRGTTAMTSAYSRATSSSSSQPM
- P43366 MAGB1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPRGQKSKLRAREKRRKAREETQGLKVAHATAAEKEECPSSSPVLGDTPTSSPAAGIPQKPQGAPPTTTAAAAVSCTESDEGAKCQGEENASFSQATTSTESSVKDPVAWEAGMLMHFILRKYKMREPIMKADMLKVVDEKYKDHFTEILNGASRRLELVFGLDLKEDNPSGHTYTLVSKLNLTNDGNLSNDWDFPRNGLLMPLLGVIFLKGNSATEEEIWKFMNVLGAYDGEEHLIYGEPRKFITQDLVQEKYLKYEQVPNSDPPRYQFLWGPRAYAETTKMKVLEFLAKMNGATPRDFPSHYEEALRDEEERAQVRSSVRARRRTTATTFRARSRAPFSRSSHPM
- O15479 MAGB2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAASSSPAAGIPQEPQRAPTTAAAAAAGVSSTKSKKGAKSHQGEKNASSSQASTSTKSPSEDPLTRKSGSLVQFLLYKYKIKKSVTKGEMLKIVGKRFREHFPEILKKASEGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFPRRKLLMPLLGVIFLNGNSATEEEIWEFLNMLGVYDGEEHSVFGEPWKLITKDLVQEKYLEYKQVPSSDPPRFQFLWGPRAYAETSKMKVLEFLAKVNGTTPCAFPTHYEEALKDEEKAGV
- Q96LZ2 MAGBA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPRGQKSKLRAREKRRQARGGLEDLIDALDILEEEEESPPSASACLKDVFQSSLDGASNNPHGLREAQSTSTSATAASHTRHPEGVNDQMEERPICTQDLEATDSFPRGPVDEKVIILVHYLLYKYQMKEPITKADMLRNVTQMSKSQFPVILSRASEHLELIFGLDLKEVEPNKHIYVLVNKLDLGCDAKLSDETGVPKTGLLMTVLGIIFTNGNCVAEEEVWKVFNTMGLYDGIEHFMFGEPRKLLTKDLVKENYLEYQQVPNSDPPRYQFLWGPRAHAETSKMKVLEFLAKVNDTAPSEFSNWYTEALQDEEERARARVAAKARVSATAGARSKVKSSKSSQLQ
- Q96M61 MAGBI_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPRGQKSKLRAREKRHQARCENQDLGATQATVAEGESPSPAYLLFGDRPQNLPAAETPSIPEALQGAPSTTNAIAPVSCSSNEGASSQDEKSLGSSREAEGWKEDPLNKKVVSLVHFLLQKYETKEPITKGDMIKFVIRKDKCHFNEILKRASEHMELALGVDLKEVDPIRHYYAFFSKLDLTYDETTSDEEKIPKTGLLMIALGVIFLNGNRAPEEAVWEIMNMMGVYADRKHFLYGDPRKVMTKDLVQLKYLEYQQVPNSDPPRYEFLWGPRAHAETSKMKVLEFVAKIHDTVPSAFPSCYEEALRDEEQRTQARAAARAHTAAMANARSRTTSSSFSHAK
研究背景
Cytoplasm.
Expressed in testis.
Expressed only in testis.
May enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex.
Expressed in testis and placenta, and in a significant fraction of tumors of various histologic types.
May enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex.
Cytoplasm.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.