Cytochrome P450 2A6/7/13 Antibody - #DF10129
製品説明
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
引用形式: Affinity Biosciences Cat# DF10129, RRID:AB_2840709.
折りたたみ／展開
Coumarin 7 hydroxylase; Coumarin 7-hydroxylase; CP2A6_HUMAN; CPA6; CYP2A; CYP2A3; CYP2A6; CYPIIA6; Cytochrome P450 2A6; Cytochrome P450 IIA3; Cytochrome P450 subfamily IIA (phenobarbital inducible) polypeptide 6; Cytochrome P450(I); Cytochrome P450, family 2 subfamily A polypeptide 6; Flavoprotein linked monooxygenase; P450C2A; P450PB; Xenobiotic monooxygenase; CP2A7_HUMAN; CPA7; CPAD; CYP2A 7; CYP2A; CYP2A7; CYPIIA7; Cytochrome P450 2A7; Cytochrome P450 family 2 subfamily A polypeptide 7; Cytochrome P450 IIA4; Cytochrome P450 subfamily IIA (phenobarbital inducible) polypeptide 7; Cytochrome P450IIA4; P450 IIA4; CP2AD_HUMAN; CPAD; CYP2A; CYP2A13; CYPIIA13; Cytochrome P450 2A13; CYTOCHROME P450, SUBFAMILY IIA, POLYPEPTIDE 13;
免疫原
Liver.
Q16696 CP2AD_HUMAN:Expressed in liver and a number of extrahepatic tissues, including nasal mucosa, lung, trachea, brain, mammary gland, prostate, testis, and uterus, but not in heart, kidney, bone marrow, colon, small intestine, spleen, stomach, thymus, or skeletal muscle.
- P11509 CP2A6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLASGMLLVALLVCLTVMVLMSVWQQRKSKGKLPPGPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFTIHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGYGVVFSNGERAKQLRRFSIATLRDFGVGKRGIEERIQEEAGFLIDALRGTGGANIDPTFFLSRTVSNVISSIVFGDRFDYKDKEFLSLLRMMLGIFQFTSTSTGQLYEMFSSVMKHLPGPQQQAFQLLQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFIGGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYMEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVYPMLGSVLRDPSFFSNPQDFNPQHFLNEKGQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVGFATIPRNYTMSFLPR
- P20853 CP2A7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLNTEHICDSIMKFSECYGPVFTIHLGPRRVVVLCGHDAVREALVDQAEEFSGRGEQATFDWVFKGYGVAFSNGERAKQLLRFAIATLRDFGVGKRGIEERIQEESGFLIEAIRSTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLSMMLGIFQFTSTSTGQLYEMFSSVMKHLPGPQQQAFKLLQGLEDFIAKKVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFIAGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRTKMPYMEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVFPMLGSVLRDPSFFSNPQDFNPQHFLDDKGQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVVFATIPRNYTMSFLPR
- Q16696 CP2AD_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLASGLLLVTLLACLTVMVLMSVWRQRKSRGKLPPGPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFTIHLGPRRVVVLCGHDAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSNGERAKQLRRFSIATLRGFGVGKRGIEERIQEEAGFLIDALRGTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFFAGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYTEAVIHEIQRFGDMLPMGLAHRVNKDTKFRDFFLPKGTEVFPMLGSVLRDPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKDIDVSPKHVGFATIPRNYTMSFLPR
種類予測
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P11509/P20853/Q16696 基板として
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S4 | Phosphorylation | Uniprot | |
| T16 | Phosphorylation | Uniprot | |
| S22 | Phosphorylation | Uniprot | |
| S131 | Phosphorylation | Uniprot | |
| R148 | Methylation | Uniprot | |
| R161 | Methylation | Uniprot | |
| T163 | Phosphorylation | Uniprot | |
| S175 | Phosphorylation | Uniprot | |
| T177 | Phosphorylation | Uniprot | |
| S183 | Phosphorylation | Uniprot | |
| S184 | Phosphorylation | Uniprot | |
| T295 | Phosphorylation | Uniprot | |
| S403 | Phosphorylation | Uniprot | |
| K436 | Acetylation | Uniprot | |
| T488 | Phosphorylation | Uniprot |
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S131 | Phosphorylation | Uniprot | |
| S175 | Phosphorylation | Uniprot | |
| T177 | Phosphorylation | Uniprot | |
| S183 | Phosphorylation | Uniprot | |
| S184 | Phosphorylation | Uniprot | |
| K436 | Acetylation | Uniprot | |
| T488 | Phosphorylation | Uniprot |
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S175 | Phosphorylation | Uniprot | |
| T177 | Phosphorylation | Uniprot | |
| S183 | Phosphorylation | Uniprot | |
| S184 | Phosphorylation | Uniprot | |
| Y351 | Phosphorylation | Uniprot | |
| K436 | Acetylation | Uniprot | |
| T482 | Phosphorylation | Uniprot | |
| T488 | Phosphorylation | Uniprot |
研究背景
Exhibits a high coumarin 7-hydroxylase activity. Can act in the hydroxylation of the anti-cancer drugs cyclophosphamide and ifosphamide. Competent in the metabolic activation of aflatoxin B1. Constitutes the major nicotine C-oxidase. Acts as a 1,4-cineole 2-exo-monooxygenase. Possesses low phenacetin O-deethylation activity.
Endoplasmic reticulum membrane>Peripheral membrane protein. Microsome membrane>Peripheral membrane protein.
Liver.
Belongs to the cytochrome P450 family.
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
Endoplasmic reticulum membrane>Peripheral membrane protein. Microsome membrane>Peripheral membrane protein.
Belongs to the cytochrome P450 family.
Exhibits a coumarin 7-hydroxylase activity. Active in the metabolic activation of hexamethylphosphoramide, N,N-dimethylaniline, 2'-methoxyacetophenone, N-nitrosomethylphenylamine, and the tobacco-specific carcinogen, 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone. Possesses phenacetin O-deethylation activity.
Endoplasmic reticulum membrane>Peripheral membrane protein. Microsome membrane>Peripheral membrane protein.
Expressed in liver and a number of extrahepatic tissues, including nasal mucosa, lung, trachea, brain, mammary gland, prostate, testis, and uterus, but not in heart, kidney, bone marrow, colon, small intestine, spleen, stomach, thymus, or skeletal muscle.
Belongs to the cytochrome P450 family.
研究領域
· Human Diseases > Cancers: Overview > Chemical carcinogenesis.
· Metabolism > Biosynthesis of other secondary metabolites > Caffeine metabolism.
· Metabolism > Metabolism of cofactors and vitamins > Retinol metabolism.
· Metabolism > Xenobiotics biodegradation and metabolism > Metabolism of xenobiotics by cytochrome P450.
· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - cytochrome P450.
· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - other enzymes.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.